RSL24D1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17700
Artikelname: RSL24D1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17700
Hersteller Artikelnummer: A17700
Alternativnummer: ABB-A17700-100UL,ABB-A17700-20UL,ABB-A17700-1000UL,ABB-A17700-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: L30, RLP24, RPL24, TVAS3, RPL24L, C15orf15, HRP-L30-iso, RSL24D1
This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes.
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 51187
UniProt: Q9UHA3
Reinheit: Affinity purification
Sequenz: SGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIK
Target-Kategorie: RSL24D1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using RSL24D1 Rabbit pAb (A17700) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.