RSL24D1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17700
Article Name: RSL24D1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17700
Supplier Catalog Number: A17700
Alternative Catalog Number: ABB-A17700-100UL,ABB-A17700-20UL,ABB-A17700-1000UL,ABB-A17700-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: L30, RLP24, RPL24, TVAS3, RPL24L, C15orf15, HRP-L30-iso, RSL24D1
This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes.
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 51187
UniProt: Q9UHA3
Purity: Affinity purification
Sequence: SGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIK
Target: RSL24D1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using RSL24D1 Rabbit pAb (A17700) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.