ARHGEF10L Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17716
Artikelname: ARHGEF10L Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17716
Hersteller Artikelnummer: A17716
Alternativnummer: ABB-A17716-100UL,ABB-A17716-20UL,ABB-A17716-1000UL,ABB-A17716-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GrinchGEF, ARHGEF10L
This gene belongs to the RhoGEF subfamily of RhoGTPases. Members of this subfamily are activated by specific guanine nucleotide exchange factors (GEFs) and are involved in signal transduction. The encoded protein shows cytosolic distribution. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 140kDa
NCBI: 55160
UniProt: Q9HCE6
Reinheit: Affinity purification
Sequenz: SHVGRELTRKKGILLQYRLRSTAHLPGPLLSMREPAPADGAALEHSEEDGSIYEMADDPDIWVRSRPCARDAHRKEICSVAIISGGQGYRNFGSALGSSGRQAPCGETDST
Target-Kategorie: ARHGEF10L
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Cell Cycle,Centrosome. Shipping: Ice Bag
Western blot analysis of lysates from Rat lung, using ARHGEF10L Rabbit pAb (A17716) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.