ARHGEF10L Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17716
Article Name: ARHGEF10L Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17716
Supplier Catalog Number: A17716
Alternative Catalog Number: ABB-A17716-100UL,ABB-A17716-20UL,ABB-A17716-1000UL,ABB-A17716-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GrinchGEF, ARHGEF10L
This gene belongs to the RhoGEF subfamily of RhoGTPases. Members of this subfamily are activated by specific guanine nucleotide exchange factors (GEFs) and are involved in signal transduction. The encoded protein shows cytosolic distribution. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 140kDa
NCBI: 55160
UniProt: Q9HCE6
Purity: Affinity purification
Sequence: SHVGRELTRKKGILLQYRLRSTAHLPGPLLSMREPAPADGAALEHSEEDGSIYEMADDPDIWVRSRPCARDAHRKEICSVAIISGGQGYRNFGSALGSSGRQAPCGETDST
Target: ARHGEF10L
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Cell Cycle,Centrosome. Shipping: Ice Bag
Western blot analysis of lysates from Rat lung, using ARHGEF10L Rabbit pAb (A17716) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.