VPS37B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17770
Artikelname: VPS37B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17770
Hersteller Artikelnummer: A17770
Alternativnummer: ABB-A17770-20UL,ABB-A17770-100UL,ABB-A17770-500UL,ABB-A17770-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: VPS37B
Enables calcium-dependent protein binding activity. Involved in positive regulation of viral budding via host ESCRT complex. Located in endosome membrane, midbody, and plasma membrane. Part of ESCRT I complex.
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 79720
UniProt: Q9H9H4
Reinheit: Affinity purification
Sequenz: LLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLP
Target-Kategorie: VPS37B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of lysates from Rat thymus, using VPS37B Rabbit pAb (A17770) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.