VPS37B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17770
Article Name: VPS37B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17770
Supplier Catalog Number: A17770
Alternative Catalog Number: ABB-A17770-20UL,ABB-A17770-100UL,ABB-A17770-500UL,ABB-A17770-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: VPS37B
Enables calcium-dependent protein binding activity. Involved in positive regulation of viral budding via host ESCRT complex. Located in endosome membrane, midbody, and plasma membrane. Part of ESCRT I complex.
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 79720
UniProt: Q9H9H4
Purity: Affinity purification
Sequence: LLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLP
Target: VPS37B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of lysates from Rat thymus, using VPS37B Rabbit pAb (A17770) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.