DCAF17 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17776
Artikelname: DCAF17 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17776
Hersteller Artikelnummer: A17776
Alternativnummer: ABB-A17776-20UL,ABB-A17776-100UL,ABB-A17776-500UL,ABB-A17776-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: C2orf37, C20orf37, DCAF17
This gene encodes a nuclear transmembrane protein that associates with cullin 4A/damaged DNA binding protein 1 ubiquitin ligase complex. Mutations in this gene are associated with Woodhouse-Sakati syndrome. Alternate splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 80067
UniProt: Q5H9S7
Reinheit: Affinity purification
Sequenz: LYSFQTIAEQFMQQKLDLGCACRWGGTTGTVGEAPFGIPCNIKITDMPPLLFEVSSLENAFQIGGHPWHYIVTPNKKKQKGVFHICALKDNSLAKNGIQEM
Target-Kategorie: DCAF17
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag
Western blot analysis of various lysates using DCAF17 Rabbit pAb (A17776) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.