DCAF17 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17776
Article Name: DCAF17 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17776
Supplier Catalog Number: A17776
Alternative Catalog Number: ABB-A17776-20UL,ABB-A17776-100UL,ABB-A17776-500UL,ABB-A17776-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: C2orf37, C20orf37, DCAF17
This gene encodes a nuclear transmembrane protein that associates with cullin 4A/damaged DNA binding protein 1 ubiquitin ligase complex. Mutations in this gene are associated with Woodhouse-Sakati syndrome. Alternate splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 80067
UniProt: Q5H9S7
Purity: Affinity purification
Sequence: LYSFQTIAEQFMQQKLDLGCACRWGGTTGTVGEAPFGIPCNIKITDMPPLLFEVSSLENAFQIGGHPWHYIVTPNKKKQKGVFHICALKDNSLAKNGIQEM
Target: DCAF17
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag
Western blot analysis of various lysates using DCAF17 Rabbit pAb (A17776) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.