MARVELD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17787
Artikelname: MARVELD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17787
Hersteller Artikelnummer: A17787
Alternativnummer: ABB-A17787-20UL,ABB-A17787-100UL,ABB-A17787-1000UL,ABB-A17787-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GB14, MARVD1, MRVLDC1, bA548K23.8, MARVELD1
Predicted to be a structural constituent of myelin sheath. Predicted to be involved in myelination. Predicted to be located in several cellular components, including cytoskeleton, nucleus, and plasma membrane. Predicted to be integral component of membrane.
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 83742
UniProt: Q9BSK0
Reinheit: Affinity purification
Sequenz: MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIA
Target-Kategorie: MARVELD1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers. Shipping: Ice Bag
Western blot analysis of various lysates using MARVELD1 Rabbit pAb (A17787) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 300s.