MARVELD1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17787
Article Name: MARVELD1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17787
Supplier Catalog Number: A17787
Alternative Catalog Number: ABB-A17787-20UL,ABB-A17787-100UL,ABB-A17787-1000UL,ABB-A17787-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GB14, MARVD1, MRVLDC1, bA548K23.8, MARVELD1
Predicted to be a structural constituent of myelin sheath. Predicted to be involved in myelination. Predicted to be located in several cellular components, including cytoskeleton, nucleus, and plasma membrane. Predicted to be integral component of membrane.
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 83742
UniProt: Q9BSK0
Purity: Affinity purification
Sequence: MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIA
Target: MARVELD1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers. Shipping: Ice Bag
Western blot analysis of various lysates using MARVELD1 Rabbit pAb (A17787) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 300s.