EAF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17798
Artikelname: EAF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17798
Hersteller Artikelnummer: A17798
Alternativnummer: ABB-A17798-20UL,ABB-A17798-100UL,ABB-A17798-500UL,ABB-A17798-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: EAF1
Enables transcription elongation regulator activity. Involved in regulation of transcription elongation from RNA polymerase II promoter. Located in intercellular bridge and nuclear body. Part of transcription elongation factor complex.
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 85403
UniProt: Q96JC9
Reinheit: Affinity purification
Sequenz: LQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEYVLEKLSSSIQVKKTRAEGSSKIQ
Target-Kategorie: EAF1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using EAF1 Rabbit pAb (A17798) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.