EAF1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17798
Article Name: EAF1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17798
Supplier Catalog Number: A17798
Alternative Catalog Number: ABB-A17798-20UL,ABB-A17798-100UL,ABB-A17798-500UL,ABB-A17798-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: EAF1
Enables transcription elongation regulator activity. Involved in regulation of transcription elongation from RNA polymerase II promoter. Located in intercellular bridge and nuclear body. Part of transcription elongation factor complex.
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 85403
UniProt: Q96JC9
Purity: Affinity purification
Sequence: LQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEYVLEKLSSSIQVKKTRAEGSSKIQ
Target: EAF1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using EAF1 Rabbit pAb (A17798) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.