TUBGCP5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17815
Artikelname: TUBGCP5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17815
Hersteller Artikelnummer: A17815
Alternativnummer: ABB-A17815-100UL,ABB-A17815-20UL,ABB-A17815-1000UL,ABB-A17815-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GCP5, TUBGCP5
Enables microtubule binding activity. Involved in microtubule nucleation. Located in centrosome and cytosol. Part of gamma-tubulin large complex.
Klonalität: Polyclonal
Molekulargewicht: 118kDa
NCBI: 114791
UniProt: Q96RT8
Reinheit: Affinity purification
Sequenz: KEIKTDAHYSILSLLLCLSDSPSNSSYVETPRNKEVEKKDDFDWGKYLMEDEEMDIGPYMDTPNWSEESEEENDQQPLSREDSGIQVDRTPLEEQDQNRKL
Target-Kategorie: TUBGCP5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cytoskeleton,Microtubules. Shipping: Ice Bag
Western blot analysis of lysates from Rat heart, using TUBGCP5 Rabbit pAb (A17815) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.