TUBGCP5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17815
Article Name: TUBGCP5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17815
Supplier Catalog Number: A17815
Alternative Catalog Number: ABB-A17815-100UL,ABB-A17815-20UL,ABB-A17815-1000UL,ABB-A17815-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GCP5, TUBGCP5
Enables microtubule binding activity. Involved in microtubule nucleation. Located in centrosome and cytosol. Part of gamma-tubulin large complex.
Clonality: Polyclonal
Molecular Weight: 118kDa
NCBI: 114791
UniProt: Q96RT8
Purity: Affinity purification
Sequence: KEIKTDAHYSILSLLLCLSDSPSNSSYVETPRNKEVEKKDDFDWGKYLMEDEEMDIGPYMDTPNWSEESEEENDQQPLSREDSGIQVDRTPLEEQDQNRKL
Target: TUBGCP5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cytoskeleton,Microtubules. Shipping: Ice Bag
Western blot analysis of lysates from Rat heart, using TUBGCP5 Rabbit pAb (A17815) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.