DNAJC18 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17843
Artikelname: DNAJC18 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17843
Hersteller Artikelnummer: A17843
Alternativnummer: ABB-A17843-100UL,ABB-A17843-20UL,ABB-A17843-1000UL,ABB-A17843-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DNAJC18
Predicted to enable Hsp70 protein binding activity. Predicted to be involved in cellular response to misfolded protein, chaperone cofactor-dependent protein refolding, and ubiquitin-dependent ERAD pathway. Predicted to be integral component of membrane. Predicted to be active in endoplasmic reticulum membrane.
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 202052
UniProt: Q9H819
Reinheit: Affinity purification
Sequenz: STLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIEKDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSK
Target-Kategorie: DNAJC18
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using DNAJC18 Rabbit pAb (A17843) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 300s.