DNAJC18 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17843
Article Name: DNAJC18 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17843
Supplier Catalog Number: A17843
Alternative Catalog Number: ABB-A17843-100UL,ABB-A17843-20UL,ABB-A17843-1000UL,ABB-A17843-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DNAJC18
Predicted to enable Hsp70 protein binding activity. Predicted to be involved in cellular response to misfolded protein, chaperone cofactor-dependent protein refolding, and ubiquitin-dependent ERAD pathway. Predicted to be integral component of membrane. Predicted to be active in endoplasmic reticulum membrane.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 202052
UniProt: Q9H819
Purity: Affinity purification
Sequence: STLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIEKDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSK
Target: DNAJC18
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using DNAJC18 Rabbit pAb (A17843) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 300s.