EML3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17846
Artikelname: EML3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17846
Hersteller Artikelnummer: A17846
Alternativnummer: ABB-A17846-20UL,ABB-A17846-100UL,ABB-A17846-500UL,ABB-A17846-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ELP95, EMAP3, EMAP95, EML3
Predicted to enable microtubule binding activity. Involved in mitotic metaphase plate congression and regulation of mitotic spindle assembly. Located in several cellular components, including midbody, mitotic spindle microtubule, and nucleus.
Klonalität: Polyclonal
Molekulargewicht: 95kDa
NCBI: 256364
UniProt: Q32P44
Reinheit: Affinity purification
Sequenz: HYRGHTDCVRCLAVHPDGVRVASGQTAGVDKDGKPLQPVVHIWDSETLLKLQEIGLGAFERGVGALAFSAADQGAFLCVVDDSNEHMLSVWDCSRGMKLAEIKSTNDSVLAVGFNPRDSSCIVTSGKSHVHFWNWSGGVGVPGNGTLTRKQGVFGKYKKPKFIPCFVFLPDGDILTGDSEGNILTWGRSPSDSKTPGRGGAKETYGIVAQAHAHEGSIFALCLRRDGTVLS
Target-Kategorie: EML3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cell Cycle,Cytoskeleton,Microtubules. Shipping: Ice Bag
Western blot analysis of lysates from THP-1 cells, using EML3 Rabbit pAb (A17846) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.