EML3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A17846
- Images (1)
| Article Name: | EML3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A17846 |
| Supplier Catalog Number: | A17846 |
| Alternative Catalog Number: | ABB-A17846-20UL,ABB-A17846-100UL,ABB-A17846-500UL,ABB-A17846-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ELP95, EMAP3, EMAP95, EML3 |
| Predicted to enable microtubule binding activity. Involved in mitotic metaphase plate congression and regulation of mitotic spindle assembly. Located in several cellular components, including midbody, mitotic spindle microtubule, and nucleus. |
| Clonality: | Polyclonal |
| Molecular Weight: | 95kDa |
| NCBI: | 256364 |
| UniProt: | Q32P44 |
| Purity: | Affinity purification |
| Sequence: | HYRGHTDCVRCLAVHPDGVRVASGQTAGVDKDGKPLQPVVHIWDSETLLKLQEIGLGAFERGVGALAFSAADQGAFLCVVDDSNEHMLSVWDCSRGMKLAEIKSTNDSVLAVGFNPRDSSCIVTSGKSHVHFWNWSGGVGVPGNGTLTRKQGVFGKYKKPKFIPCFVFLPDGDILTGDSEGNILTWGRSPSDSKTPGRGGAKETYGIVAQAHAHEGSIFALCLRRDGTVLS |
| Target: | EML3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Cell Cycle,Cytoskeleton,Microtubules. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from THP-1 cells, using EML3 Rabbit pAb (A17846) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Product Guarantee and Expert Support
