EML3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17846
Article Name: EML3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17846
Supplier Catalog Number: A17846
Alternative Catalog Number: ABB-A17846-20UL,ABB-A17846-100UL,ABB-A17846-500UL,ABB-A17846-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ELP95, EMAP3, EMAP95, EML3
Predicted to enable microtubule binding activity. Involved in mitotic metaphase plate congression and regulation of mitotic spindle assembly. Located in several cellular components, including midbody, mitotic spindle microtubule, and nucleus.
Clonality: Polyclonal
Molecular Weight: 95kDa
NCBI: 256364
UniProt: Q32P44
Purity: Affinity purification
Sequence: HYRGHTDCVRCLAVHPDGVRVASGQTAGVDKDGKPLQPVVHIWDSETLLKLQEIGLGAFERGVGALAFSAADQGAFLCVVDDSNEHMLSVWDCSRGMKLAEIKSTNDSVLAVGFNPRDSSCIVTSGKSHVHFWNWSGGVGVPGNGTLTRKQGVFGKYKKPKFIPCFVFLPDGDILTGDSEGNILTWGRSPSDSKTPGRGGAKETYGIVAQAHAHEGSIFALCLRRDGTVLS
Target: EML3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cell Cycle,Cytoskeleton,Microtubules. Shipping: Ice Bag
Western blot analysis of lysates from THP-1 cells, using EML3 Rabbit pAb (A17846) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.