VWC2L Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17853
Artikelname: VWC2L Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17853
Hersteller Artikelnummer: A17853
Alternativnummer: ABB-A17853-100UL,ABB-A17853-20UL,ABB-A17853-1000UL,ABB-A17853-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: Brl, A830006F12Rik, VWC2L
Acts upstream of or within negative regulation of BMP signaling pathway and positive regulation of neuron differentiation. Located in extracellular space. Part of AMPA glutamate receptor complex. Is expressed in brain, central nervous system, hippocampus, hypothalamus, and thalamus. Orthologous to human VWC2L (von Willebrand factor C domain containing 2 like).
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 320460
UniProt: Q505H4
Reinheit: Affinity purification
Sequenz: MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQASSNDNLIFDDYRG
Target-Kategorie: Vwc2l
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using VWC2L Rabbit pAb (A17853) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.