VWC2L Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17853
Article Name: VWC2L Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17853
Supplier Catalog Number: A17853
Alternative Catalog Number: ABB-A17853-100UL,ABB-A17853-20UL,ABB-A17853-1000UL,ABB-A17853-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Brl, A830006F12Rik, VWC2L
Acts upstream of or within negative regulation of BMP signaling pathway and positive regulation of neuron differentiation. Located in extracellular space. Part of AMPA glutamate receptor complex. Is expressed in brain, central nervous system, hippocampus, hypothalamus, and thalamus. Orthologous to human VWC2L (von Willebrand factor C domain containing 2 like).
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 320460
UniProt: Q505H4
Purity: Affinity purification
Sequence: MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQASSNDNLIFDDYRG
Target: Vwc2l
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using VWC2L Rabbit pAb (A17853) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.