SNAI3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17854
Artikelname: SNAI3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17854
Hersteller Artikelnummer: A17854
Alternativnummer: ABB-A17854-100UL,ABB-A17854-20UL,ABB-A17854-1000UL,ABB-A17854-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SMUC, SNAIL3, ZNF293, Zfp293, SNAI3
SNAI3 is a member of the SNAIL gene family, named for the Drosophila snail gene, which plays roles in mesodermal formation during embryogenesis (Katoh and Katoh, 2003 [PubMed 12579345]).
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 333929
UniProt: Q3KNW1
Reinheit: Affinity purification
Sequenz: VKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWDRSSAVACISLPLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCK
Target-Kategorie: SNAI3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates using SNAI3 Rabbit pAb (A17854) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.