SNAI3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17854
Article Name: SNAI3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17854
Supplier Catalog Number: A17854
Alternative Catalog Number: ABB-A17854-100UL,ABB-A17854-20UL,ABB-A17854-1000UL,ABB-A17854-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SMUC, SNAIL3, ZNF293, Zfp293, SNAI3
SNAI3 is a member of the SNAIL gene family, named for the Drosophila snail gene, which plays roles in mesodermal formation during embryogenesis (Katoh and Katoh, 2003 [PubMed 12579345]).
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 333929
UniProt: Q3KNW1
Purity: Affinity purification
Sequence: VKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWDRSSAVACISLPLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCK
Target: SNAI3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates using SNAI3 Rabbit pAb (A17854) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.