SMC2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17867
Artikelname: SMC2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17867
Hersteller Artikelnummer: A17867
Alternativnummer: ABB-A17867-20UL,ABB-A17867-100UL,ABB-A17867-1000UL,ABB-A17867-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CAPE, CAP-E, SMC-2, SMC2L1, SMC2
Predicted to enable ATP binding activity, chromatin binding activity, and single-stranded DNA binding activity. Involved in mitotic chromosome condensation. Located in condensed chromosome, cytoplasm, and nuclear lumen. Part of condensin complex.
Klonalität: Polyclonal
Molekulargewicht: 136kDa
NCBI: 10592
UniProt: O95347
Reinheit: Affinity purification
Sequenz: EELAGLKNTAEKYRQLKQQWEMKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAEEKYEVLENKMKNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQLEAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQDTVIKAKYAEVAKHK
Target-Kategorie: SMC2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle. Shipping: Ice Bag
Western blot analysis of various lysates using SMC2 Rabbit pAb (A17867) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.