SMC2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17867
Article Name: SMC2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17867
Supplier Catalog Number: A17867
Alternative Catalog Number: ABB-A17867-20UL,ABB-A17867-100UL,ABB-A17867-1000UL,ABB-A17867-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CAPE, CAP-E, SMC-2, SMC2L1, SMC2
Predicted to enable ATP binding activity, chromatin binding activity, and single-stranded DNA binding activity. Involved in mitotic chromosome condensation. Located in condensed chromosome, cytoplasm, and nuclear lumen. Part of condensin complex.
Clonality: Polyclonal
Molecular Weight: 136kDa
NCBI: 10592
UniProt: O95347
Purity: Affinity purification
Sequence: EELAGLKNTAEKYRQLKQQWEMKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAEEKYEVLENKMKNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQLEAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQDTVIKAKYAEVAKHK
Target: SMC2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle. Shipping: Ice Bag
Western blot analysis of various lysates using SMC2 Rabbit pAb (A17867) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.