SV2A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17868
Artikelname: SV2A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17868
Hersteller Artikelnummer: A17868
Alternativnummer: ABB-A17868-100UL,ABB-A17868-20UL,ABB-A17868-500UL,ABB-A17868-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SV2, SLC22B1, SV2A
The protein encoded by this gene is one of three related synaptic vesicle proteins. The encoded protein may interact with synaptotagmin to enhance low frequency neurotransmission in quiescent neurons.
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 9900
UniProt: Q7L0J3
Reinheit: Affinity purification
Sequenz: ESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRIT
Target-Kategorie: SV2A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Neuroscience, Cell Type Marker,Calcium Signaling,Neuron marker,Synapse marker. Shipping: Ice Bag
Western blot analysis of various lysates using SV2A Rabbit pAb (A17868) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.