SV2A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17868
Article Name: SV2A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17868
Supplier Catalog Number: A17868
Alternative Catalog Number: ABB-A17868-100UL,ABB-A17868-20UL,ABB-A17868-500UL,ABB-A17868-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SV2, SLC22B1, SV2A
The protein encoded by this gene is one of three related synaptic vesicle proteins. The encoded protein may interact with synaptotagmin to enhance low frequency neurotransmission in quiescent neurons.
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 9900
UniProt: Q7L0J3
Purity: Affinity purification
Sequence: ESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRIT
Target: SV2A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Neuroscience, Cell Type Marker,Calcium Signaling,Neuron marker,Synapse marker. Shipping: Ice Bag
Western blot analysis of various lysates using SV2A Rabbit pAb (A17868) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.