TSPY3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A17886
- Bilder (1)
| Artikelname: | TSPY3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A17886 |
| Hersteller Artikelnummer: | A17886 |
| Alternativnummer: | ABB-A17886-20UL,ABB-A17886-100UL,ABB-A17886-500UL,ABB-A17886-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CT78, TSPY, TSPY1, TSPY10, TSPY3 |
| Predicted to enable chromatin binding activity and histone binding activity. Predicted to be involved in sex differentiation. Predicted to be located in cytoplasm. Predicted to be active in chromatin and nucleus. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 35kDa |
| NCBI: | 728137 |
| UniProt: | P0CV98 |
| Reinheit: | Affinity purification |
| Sequenz: | MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSL |
| Target-Kategorie: | TSPY3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat testis, using TSPY3 Rabbit pAb (A17886) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
