TSPY3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A17886
- Images (1)
| Article Name: | TSPY3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A17886 |
| Supplier Catalog Number: | A17886 |
| Alternative Catalog Number: | ABB-A17886-20UL,ABB-A17886-100UL,ABB-A17886-500UL,ABB-A17886-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CT78, TSPY, TSPY1, TSPY10, TSPY3 |
| Predicted to enable chromatin binding activity and histone binding activity. Predicted to be involved in sex differentiation. Predicted to be located in cytoplasm. Predicted to be active in chromatin and nucleus. |
| Clonality: | Polyclonal |
| Molecular Weight: | 35kDa |
| NCBI: | 728137 |
| UniProt: | P0CV98 |
| Purity: | Affinity purification |
| Sequence: | MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSL |
| Target: | TSPY3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat testis, using TSPY3 Rabbit pAb (A17886) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Product Guarantee and Expert Support
