ETV5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17927
Artikelname: ETV5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17927
Hersteller Artikelnummer: A17927
Alternativnummer: ABB-A17927-20UL,ABB-A17927-100UL,ABB-A17927-500UL,ABB-A17927-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ERM, ETV5
Enables DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Involved in cellular response to oxidative stress, negative regulation of transcription by RNA polymerase II, and positive regulation of transcription by RNA polymerase II. Located in nucleoplasm.
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 2119
UniProt: P41161
Reinheit: Affinity purification
Sequenz: MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAEAQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNYCAYDRKPPSGFKPLTPPTTPLSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAA
Target-Kategorie: ETV5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from A-431 cells, using ETV5 Rabbit pAb (A17927) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.