ETV5 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A17927
- Images (1)
| Article Name: | ETV5 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A17927 |
| Supplier Catalog Number: | A17927 |
| Alternative Catalog Number: | ABB-A17927-20UL,ABB-A17927-100UL,ABB-A17927-500UL,ABB-A17927-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ERM, ETV5 |
| Enables DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Involved in cellular response to oxidative stress, negative regulation of transcription by RNA polymerase II, and positive regulation of transcription by RNA polymerase II. Located in nucleoplasm. |
| Clonality: | Polyclonal |
| Molecular Weight: | 58kDa |
| NCBI: | 2119 |
| UniProt: | P41161 |
| Purity: | Affinity purification |
| Sequence: | MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAEAQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNYCAYDRKPPSGFKPLTPPTTPLSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAA |
| Target: | ETV5 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from A-431 cells, using ETV5 Rabbit pAb (A17927) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
