ZDHHC20 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17982
Artikelname: ZDHHC20 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17982
Hersteller Artikelnummer: A17982
Alternativnummer: ABB-A17982-100UL,ABB-A17982-20UL,ABB-A17982-1000UL,ABB-A17982-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: DHHC20, DHHC-20, 4933421L13Rik, ZDHHC20
Enables protein-cysteine S-palmitoyltransferase activity and zinc ion binding activity. Involved in peptidyl-L-cysteine S-palmitoylation. Located in intracellular membrane-bounded organelle and plasma membrane. Is integral component of Golgi membrane.
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 253832
UniProt: Q5W0Z9
Reinheit: Affinity purification
Sequenz: VFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN
Target-Kategorie: ZDHHC20
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using ZDHHC20 Rabbit pAb (A17982) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.