ZDHHC20 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17982
Article Name: ZDHHC20 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17982
Supplier Catalog Number: A17982
Alternative Catalog Number: ABB-A17982-100UL,ABB-A17982-20UL,ABB-A17982-1000UL,ABB-A17982-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: DHHC20, DHHC-20, 4933421L13Rik, ZDHHC20
Enables protein-cysteine S-palmitoyltransferase activity and zinc ion binding activity. Involved in peptidyl-L-cysteine S-palmitoylation. Located in intracellular membrane-bounded organelle and plasma membrane. Is integral component of Golgi membrane.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 253832
UniProt: Q5W0Z9
Purity: Affinity purification
Sequence: VFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN
Target: ZDHHC20
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using ZDHHC20 Rabbit pAb (A17982) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.