MCHR1 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A18111
Artikelname: MCHR1 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A18111
Hersteller Artikelnummer: A18111
Alternativnummer: ABB-A18111-20UL,ABB-A18111-100UL,ABB-A18111-500UL,ABB-A18111-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: SLC1, GPR24, MCH1R, SLC-1, MCH-1R, MCHR1
The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin.
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 2847
UniProt: Q99705
Reinheit: Affinity purification
Sequenz: MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTS
Target-Kategorie: MCHR1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using MCHR1 Rabbit pAb (A18111) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.