MCHR1 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18111
Article Name: MCHR1 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18111
Supplier Catalog Number: A18111
Alternative Catalog Number: ABB-A18111-20UL,ABB-A18111-100UL,ABB-A18111-500UL,ABB-A18111-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: SLC1, GPR24, MCH1R, SLC-1, MCH-1R, MCHR1
The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin.
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 2847
UniProt: Q99705
Purity: Affinity purification
Sequence: MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTS
Target: MCHR1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using MCHR1 Rabbit pAb (A18111) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.