SLC22A6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1814
Artikelname: SLC22A6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1814
Hersteller Artikelnummer: A1814
Alternativnummer: ABB-A1814-500UL,ABB-A1814-20UL,ABB-A1814-1000UL,ABB-A1814-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: OAT1, PAHT, HOAT1, ROAT1, SLC22A6
The protein encoded by this gene is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane. Four transcript variants encoding four different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 9356
UniProt: Q4U2R8
Reinheit: Affinity purification
Sequenz: MASHNTLQNFTAAIPTHHCRPPADANLSKNGGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHRALRQ
Target-Kategorie: SLC22A6
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using SLC22A6 Rabbit pAb (A1814) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.