SLC22A6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1814
Article Name: SLC22A6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1814
Supplier Catalog Number: A1814
Alternative Catalog Number: ABB-A1814-500UL,ABB-A1814-20UL,ABB-A1814-1000UL,ABB-A1814-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: OAT1, PAHT, HOAT1, ROAT1, SLC22A6
The protein encoded by this gene is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane. Four transcript variants encoding four different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 9356
UniProt: Q4U2R8
Purity: Affinity purification
Sequence: MASHNTLQNFTAAIPTHHCRPPADANLSKNGGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHRALRQ
Target: SLC22A6
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using SLC22A6 Rabbit pAb (A1814) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.