TPST2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A18141
Artikelname: TPST2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A18141
Hersteller Artikelnummer: A18141
Alternativnummer: ABB-A18141-100UL,ABB-A18141-20UL,ABB-A18141-500UL,ABB-A18141-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TPST-2, TANGO13B, TPST2
The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Alternative splicing produces multiple transcript variants encoding distinct isoforms.
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 8459
UniProt: O60704
Reinheit: Affinity purification
Sequenz: SKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNST
Target-Kategorie: TPST2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Immunology Inflammation,Cardiovascular. Shipping: Ice Bag
Western blot analysis of lysates from U-2 OS cells using TPST2 Rabbit pAb (A18141) at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 60s.