TPST2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A18141
Article Name: TPST2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A18141
Supplier Catalog Number: A18141
Alternative Catalog Number: ABB-A18141-100UL,ABB-A18141-20UL,ABB-A18141-500UL,ABB-A18141-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TPST-2, TANGO13B, TPST2
The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Alternative splicing produces multiple transcript variants encoding distinct isoforms.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 8459
UniProt: O60704
Purity: Affinity purification
Sequence: SKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNST
Target: TPST2
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Immunology Inflammation,Cardiovascular. Shipping: Ice Bag
Western blot analysis of lysates from U-2 OS cells using TPST2 Rabbit pAb (A18141) at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 60s.