PIN4 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A18173
- Bilder (1)
| Artikelname: | PIN4 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A18173 |
| Hersteller Artikelnummer: | A18173 |
| Alternativnummer: | ABB-A18173-100UL,ABB-A18173-20UL,ABB-A18173-1000UL,ABB-A18173-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | EPVH, PAR14, PAR17, hEPVH, hPar14, hPar17, PIN4 |
| This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ribosome biogenesis. The encoded protein may play an additional role in the mitochondria. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 14kDa |
| NCBI: | 5303 |
| UniProt: | Q9Y237 |
| Reinheit: | Affinity purification |
| Sequenz: | MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK |
| Target-Kategorie: | PIN4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Nucleotide metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PIN4 Rabbit pAb (A18173) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 15s. |
Produktgarantie und fachkundiger Support
