PIN4 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18173
Article Name: PIN4 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18173
Supplier Catalog Number: A18173
Alternative Catalog Number: ABB-A18173-100UL,ABB-A18173-20UL,ABB-A18173-1000UL,ABB-A18173-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: EPVH, PAR14, PAR17, hEPVH, hPar14, hPar17, PIN4
This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ribosome biogenesis. The encoded protein may play an additional role in the mitochondria.
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 5303
UniProt: Q9Y237
Purity: Affinity purification
Sequence: MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Target: PIN4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Nucleotide metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using PIN4 Rabbit pAb (A18173) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.