Mrpl18 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A18186
- Bilder (1)
| Artikelname: | Mrpl18 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A18186 |
| Hersteller Artikelnummer: | A18186 |
| Alternativnummer: | ABB-A18186-100UL,ABB-A18186-20UL,ABB-A18186-500UL,ABB-A18186-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | HSPC071, MRP-L18, 1010001C05Rik, Mrpl18 |
| Predicted to enable 5S rRNA binding activity. Predicted to be involved in rRNA import into mitochondrion. Located in mitochondrion. Is expressed in several structures, including brain, connective tissue, early conceptus, genitourinary system, and gut. Orthologous to human MRPL18 (mitochondrial ribosomal protein L18). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 21kDa |
| NCBI: | 67681 |
| UniProt: | Q9CQL5 |
| Reinheit: | Affinity purification |
| Sequenz: | EAVAPEFTNRNPRNLELLGVARKERGWATVWPNREFWHRLRVVKTQHHVEAFVEHLNGQVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEASSDSIKRLQNAMTESGVMLREPRRIYE |
| Target-Kategorie: | Mrpl18 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Mrpl18 Rabbit pAb (A18186) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s. |
Produktgarantie und fachkundiger Support
