Mrpl18 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A18186
- Images (1)
| Article Name: | Mrpl18 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A18186 |
| Supplier Catalog Number: | A18186 |
| Alternative Catalog Number: | ABB-A18186-100UL,ABB-A18186-20UL,ABB-A18186-500UL,ABB-A18186-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | HSPC071, MRP-L18, 1010001C05Rik, Mrpl18 |
| Predicted to enable 5S rRNA binding activity. Predicted to be involved in rRNA import into mitochondrion. Located in mitochondrion. Is expressed in several structures, including brain, connective tissue, early conceptus, genitourinary system, and gut. Orthologous to human MRPL18 (mitochondrial ribosomal protein L18). |
| Clonality: | Polyclonal |
| Molecular Weight: | 21kDa |
| NCBI: | 67681 |
| UniProt: | Q9CQL5 |
| Purity: | Affinity purification |
| Sequence: | EAVAPEFTNRNPRNLELLGVARKERGWATVWPNREFWHRLRVVKTQHHVEAFVEHLNGQVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEASSDSIKRLQNAMTESGVMLREPRRIYE |
| Target: | Mrpl18 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Mrpl18 Rabbit pAb (A18186) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s. |
Product Guarantee and Expert Support
