DEFA5 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A18208
Artikelname: DEFA5 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A18208
Hersteller Artikelnummer: A18208
Alternativnummer: ABB-A18208-20UL,ABB-A18208-100UL,ABB-A18208-500UL,ABB-A18208-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: DEF5, HD-5, DEFA5
Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several of the alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 5, is highly expressed in the secretory granules of Paneth cells of the ileum.
Klonalität: Polyclonal
Molekulargewicht: 10kDa
NCBI: 1670
UniProt: Q01523
Reinheit: Affinity purification
Sequenz: ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
Target-Kategorie: DEFA5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. Shipping: Ice Bag
Western blot analysis of lysates from HCT116 cells, using DEFA5 Rabbit pAb (A18208) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.