DEFA5 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18208
Article Name: DEFA5 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18208
Supplier Catalog Number: A18208
Alternative Catalog Number: ABB-A18208-20UL,ABB-A18208-100UL,ABB-A18208-500UL,ABB-A18208-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: DEF5, HD-5, DEFA5
Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several of the alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 5, is highly expressed in the secretory granules of Paneth cells of the ileum.
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 1670
UniProt: Q01523
Purity: Affinity purification
Sequence: ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
Target: DEFA5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. Shipping: Ice Bag
Western blot analysis of lysates from HCT116 cells, using DEFA5 Rabbit pAb (A18208) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.