CAR/CXADR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1822
Artikelname: CAR/CXADR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1822
Hersteller Artikelnummer: A1822
Alternativnummer: ABB-A1822-20UL,ABB-A1822-100UL,ABB-A1822-1000UL,ABB-A1822-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CAR, HCAR, CAR4/6, CAR/CXADR
The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Several transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene are found on chromosomes 15, 18, and 21.
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 1525
UniProt: P78310
Reinheit: Affinity purification
Sequenz: LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAG
Target-Kategorie: CXADR
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Tight Junctions,Cytoskeleton. Shipping: Ice Bag
Western blot analysis of various lysates using CAR/CXADR Rabbit pAb (A1822) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.