CAR/CXADR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1822
- Bilder (1)
| Artikelname: | CAR/CXADR Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1822 |
| Hersteller Artikelnummer: | A1822 |
| Alternativnummer: | ABB-A1822-20UL,ABB-A1822-100UL,ABB-A1822-1000UL,ABB-A1822-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CAR, HCAR, CAR4/6, CAR/CXADR |
| The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Several transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene are found on chromosomes 15, 18, and 21. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 40kDa |
| NCBI: | 1525 |
| UniProt: | P78310 |
| Reinheit: | Affinity purification |
| Sequenz: | LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAG |
| Target-Kategorie: | CXADR |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Tight Junctions,Cytoskeleton. Shipping: Ice Bag |

