CAR/CXADR Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1822
- Images (1)
| Article Name: | CAR/CXADR Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1822 |
| Supplier Catalog Number: | A1822 |
| Alternative Catalog Number: | ABB-A1822-20UL,ABB-A1822-100UL,ABB-A1822-1000UL,ABB-A1822-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CAR, HCAR, CAR4/6, CAR/CXADR |
| The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Several transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene are found on chromosomes 15, 18, and 21. |
| Clonality: | Polyclonal |
| Molecular Weight: | 40kDa |
| NCBI: | 1525 |
| UniProt: | P78310 |
| Purity: | Affinity purification |
| Sequence: | LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAG |
| Target: | CXADR |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Tight Junctions,Cytoskeleton. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CAR/CXADR Rabbit pAb (A1822) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s. |
Product Guarantee and Expert Support
