Mrpl55 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A18244
Artikelname: Mrpl55 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A18244
Hersteller Artikelnummer: A18244
Alternativnummer: ABB-A18244-20UL,ABB-A18244-100UL,ABB-A18244-1000UL,ABB-A18244-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: L55mt, MRP-L55, 2810038N09Rik, Mrpl55
Predicted to be a structural constituent of ribosome. Predicted to be involved in translation. Located in mitochondrion. Is expressed in several structures, including early conceptus, gonad, heart, liver, and metanephros. Orthologous to human MRPL55 (mitochondrial ribosomal protein L55).
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 67212
UniProt: Q9CZ83
Reinheit: Affinity purification
Sequenz: DCSRASLTRLRRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPLDLDALSPEERRARFRKREAQLQQKREEEPEVVDSFDTERYKQFWTKTKK
Target-Kategorie: Mrpl55
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using Mrpl55 Rabbit pAb (A18244) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.