Mrpl55 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18244
Article Name: Mrpl55 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18244
Supplier Catalog Number: A18244
Alternative Catalog Number: ABB-A18244-20UL,ABB-A18244-100UL,ABB-A18244-1000UL,ABB-A18244-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: L55mt, MRP-L55, 2810038N09Rik, Mrpl55
Predicted to be a structural constituent of ribosome. Predicted to be involved in translation. Located in mitochondrion. Is expressed in several structures, including early conceptus, gonad, heart, liver, and metanephros. Orthologous to human MRPL55 (mitochondrial ribosomal protein L55).
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 67212
UniProt: Q9CZ83
Purity: Affinity purification
Sequence: DCSRASLTRLRRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPLDLDALSPEERRARFRKREAQLQQKREEEPEVVDSFDTERYKQFWTKTKK
Target: Mrpl55
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using Mrpl55 Rabbit pAb (A18244) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.