CD132/IL-2 R gamma Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1829
Artikelname: CD132/IL-2 R gamma Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1829
Hersteller Artikelnummer: A1829
Alternativnummer: ABB-A1829-100UL,ABB-A1829-20UL,ABB-A1829-500UL,ABB-A1829-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: P64, CIDX, IMD4, CD132, SCIDX, IL-2RG, SCIDX1, CD132/IL-2 R gamma
The protein encoded by this gene is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in this gene cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder.
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 3561
UniProt: P31785
Reinheit: Affinity purification
Sequenz: IPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Target-Kategorie: IL2RG
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor immunology,Immunology Inflammation,CDs,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using CD132/IL-2 R gamma Rabbit pAb (A1829) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.