CD132/IL-2 R gamma Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1829
Article Name: CD132/IL-2 R gamma Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1829
Supplier Catalog Number: A1829
Alternative Catalog Number: ABB-A1829-100UL,ABB-A1829-20UL,ABB-A1829-500UL,ABB-A1829-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: P64, CIDX, IMD4, CD132, SCIDX, IL-2RG, SCIDX1, CD132/IL-2 R gamma
The protein encoded by this gene is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in this gene cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 3561
UniProt: P31785
Purity: Affinity purification
Sequence: IPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Target: IL2RG
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor immunology,Immunology Inflammation,CDs,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using CD132/IL-2 R gamma Rabbit pAb (A1829) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.